SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383325023|ref|YP_005385876.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383325023|ref|YP_005385876.1|
Domain Number 1 Region: 3-224,348-426
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.6e-65
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00000111
Further Details:      
 
Domain Number 2 Region: 442-575
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.7e-45
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 227-349
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.39e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383325023|ref|YP_005385876.1|
Sequence length 575
Comment succinate dehydrogenase flavoprotein subunit [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MLEQDVVIVGGGLAGCRAALEIKRLAPDTKVAIVAKTHPIRSHSVAAQGGIAASLKNVDA
EDSWEAHAFDTVKGSDYLADQDAVEILTKEAPEVIIELEHLGVLFSRLPDGKIAQRAFGG
HSHNRTCYAADKTGHAILHELVNNLRRNKVEIYDEWYVMKLIYEEGEAKGLVMYEIATGR
IEIVRAKAVMVATGGYGRVYNTTSNDYASTGDGLAMAAIAGIPLEDMEFVQFHPTGLYPV
GVLISEAVRGEGAYLINSEGRRFMEDYAPSRMELAPRDITSRAITLEIRAGRGVNADGSA
GGPYVYLDLRHMGREKIMSRIPFCWEEAHRLVGIDAVEQPMPVRPTVHYCMGGIPVNTDG
RVRKNANELTEGFFAAGECACVSVHGGNRLGSNSLLECVVYGRRTGRSIAEYVQGRSLPE
IDEAVYKTEAQTRIDQLLNQQGTVRINTLRQAFQDCMTSHCGVFRSESFMAEGLEQVQNL
KAQYGQIFLDDKQPQWNTEVIEALELQSIMAVGELILTSAIQRQESRGSHAREDFPSRDD
EQFLRHTLASFDGEQIKVEYMPVVINRFEPKERKY
Download sequence
Identical sequences L8AI19 P73479
WP_010872149.1.11876 WP_010872149.1.1889 WP_010872149.1.18904 WP_010872149.1.33690 WP_010872149.1.35395 WP_010872149.1.47586 WP_010872149.1.99424 gi|16330111|ref|NP_440839.1| gi|383490907|ref|YP_005408583.1| gi|16330111|ref|NP_440839.1| 1148.slr1233 gi|383321854|ref|YP_005382707.1| gi|383325023|ref|YP_005385876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]