SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383325289|ref|YP_005386142.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383325289|ref|YP_005386142.1|
Domain Number 1 Region: 5-343
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.49e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383325289|ref|YP_005386142.1|
Sequence length 445
Comment NADH dehydrogenase [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MNSPTSPRRPHVVIVGGGFAGLYTAKNLRRSPVDITLIDKRNFHLFQPLLYQVATGSLSP
ADIASPLRGVLKGQKNIRVLMDKVIDIDPDKQKVVLEDHAPIAYDWLVVATGVSHHYFGN
DHWAALAPGLKTIEDALTIRQRIFAAFEAAEKESNPERQQAWLTFVIVGAGPTGVELAGA
IAEIAHSSLKDNFHRIDTRQAKILLIEGVDRVLPPYKPQLSARAQRDLEDLGVTVLTERM
VTDINPEQVTVHNNGQTETIVTKTVLWGAGVRASSLGKIIGDRTGAELDRAGRVVVNPDL
SVASFDNIFVLGDLANYSHQGDQPLPGVAPVAMQEAAYLSKLIPARLAEKEQIMVPFRYI
DYGSLAVIGQNKAVVDLGFAQFTGLVAWMIWVWAHVYYLIEFDNKLIVMLQWGWNYFTRG
RGARLITDTPNPQSTSTVQKELVRP
Download sequence
Identical sequences L8AHN8 P73739
gi|383491173|ref|YP_005408849.1| 1148.slr0851 gi|383322120|ref|YP_005382973.1| gi|16330379|ref|NP_441107.1| WP_010872417.1.11876 WP_010872417.1.1889 WP_010872417.1.18904 WP_010872417.1.33690 WP_010872417.1.35395 WP_010872417.1.47586 WP_010872417.1.99424 gi|383325289|ref|YP_005386142.1| gi|16330379|ref|NP_441107.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]