SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383325388|ref|YP_005386241.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383325388|ref|YP_005386241.1|
Domain Number 1 Region: 4-174,277-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383325388|ref|YP_005386241.1|
Sequence length 425
Comment hypothetical protein SYNPCCP_1309 [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MEEFAVVIIGAGPAGGQCARQLAQQGVRVLLVEQHSNFSQNNYSSAASPLETMALFDLPP
GVVARYWRNLAIAATEKEQIWYSDQPRGVVFDFAKLRQFLADTVTKAGGQVWLGHRFWGY
QQVGDGLEVTLRRSSKNSLSSDSVEKVEKVTVKTQVLIDATGSKRAVINCGQPKATDNNQ
YYRGIGTEYLITVDETTHQRFADTLVFFLGYRWSPQGYSWIFPMDNHQLKVGTAIFAGQH
RYLGELKPLRSYTEAIIRDYLKLEKSQYHLEEIHGSVLDYAVNQGDTYHRGSVLAIGDAV
STVNFLGGEGIRHGMQGANIAVPFVADYLRGHVQAFEKYEQAMKAHFAEPWQRTEKLSQR
VYLEFGDRQIDLGVTYLSYLRYDDVLDLLFHYRFDRIYGGITPLLLKKVAQFSQQCRQWL
RKLSP
Download sequence
Identical sequences L8AHY2 P73829
1148.slr1998 gi|16330478|ref|NP_441206.1| gi|16330478|ref|NP_441206.1| gi|383325388|ref|YP_005386241.1| gi|383491272|ref|YP_005408948.1| gi|383322219|ref|YP_005383072.1| WP_010872515.1.11876 WP_010872515.1.1889 WP_010872515.1.18904 WP_010872515.1.33690 WP_010872515.1.35395 WP_010872515.1.47586 WP_010872515.1.99424 SgR60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]