SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383325842|ref|YP_005386695.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383325842|ref|YP_005386695.1|
Domain Number 1 Region: 4-171,268-381
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-38
Family FAD-linked reductases, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383325842|ref|YP_005386695.1|
Sequence length 407
Comment geranylgeranyl reductase [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MVLRVAVVGGGPAGSSAAEILVKAGIETYLFERKLDNAKPCGGAIPLCMVDEFDLPPEII
DRRVRKMKMISPSNIEVNIGQTLKDDEYIGMCRREVLDGFLRERAEKLGTKVINGTVYKL
DIPSKDSDPYTLHYADHSVGGTTGEMKILKVDVVIGADGANSRIAKAIDAGDYNYAIAFQ
ERIRLPEDKMAYYDELAEMYVGDDVSPDFYAWVFPKYDHVAVGTGTMKVNKARIKDLQAG
IRTRAAKKLEGGEIIKVEAHPIPEHPRPRRVVGRVALVGDAAGTVTKSSGEGIYFAAKSA
RMCAETIVATSNNGQRVPTEADLKQYIKQWDKRYGATYLVLDILQRVFYRTDATREAFVE
MCSDIDVQKLTFDSYLYKTVVPANPLVQMKITAKTIGSLLRGNALAP
Download sequence
Identical sequences L8ATV2 Q55087
gi|383491726|ref|YP_005409402.1| gi|383322673|ref|YP_005383526.1| gi|304569546|ref|NP_441659.2| gi|383325842|ref|YP_005386695.1| gi|304569546|ref|NP_441659.2| WP_010872959.1.11876 WP_010872959.1.1889 WP_010872959.1.18904 WP_010872959.1.33690 WP_010872959.1.35395 WP_010872959.1.47586 WP_010872959.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]