SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383325854|ref|YP_005386707.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383325854|ref|YP_005386707.1|
Domain Number 1 Region: 12-350
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.77e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383325854|ref|YP_005386707.1|
Sequence length 553
Comment glycerol-3-phosphate dehydrogenase [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MRNFPEIQNTAYDLIVIGGGINGVGTARDGALRGLKTLLIEKDDFASGTSSWSTRLIHGG
LRYLEYFEFNLVRESLREREVLLHTAPHLVQPLQLTIPVYDWSSRAYWEIQAGMILYDIL
SFDKTLPSHRMLSPQQFQQLFRAAEKKGLKGGAQYFDGQVEYAERLDLEVTLSAQKAGAA
MLNYVAVKGLEKGENNLITAIHCQDQLSGEKFTVNSAQAIVINTTGPWVDEVCGLAHRGG
EPVAIVQERKIGGTKGSHIVVDPFPGAPASALYVEAFVDKRPYFIIPWLGKYLIGTTDHR
YDGSLDRVKASDDEIDYLIAETNRVMPAAQLTRQDVRFTYSGVRPLPYTDGKKAGSITRN
HILYDHSQDGVNNLISLIGGKLTTYRQVGEEMVDKVYGKLRRSAPPCPTLTQPLPGAEAY
PLSLETAMDKYGNHLERHSIQHLFCLYGARAGDILALVHGAPELGERIIPSLPDIKAQVV
FAVQAEMAHTLVDICRRRTAIAMVTNDYGFSALAGICQTLTDHCGWTQEQCDKQIQKYHE
YMEQNCIPDYCLH
Download sequence
Identical sequences L8ATW3 P74257
gi|383322685|ref|YP_005383538.1| gi|383325854|ref|YP_005386707.1| gi|16330943|ref|NP_441671.1| gi|16330943|ref|NP_441671.1| 1148.sll1085 WP_010872971.1.11876 WP_010872971.1.1889 WP_010872971.1.18904 WP_010872971.1.33690 WP_010872971.1.35395 WP_010872971.1.47586 WP_010872971.1.99424 gi|383491738|ref|YP_005409414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]