SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383326336|ref|YP_005387189.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383326336|ref|YP_005387189.1|
Domain Number 1 Region: 12-72,103-268
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.47e-42
Family GidA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383326336|ref|YP_005387189.1|
Sequence length 635
Comment glucose inhibited division protein A [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MTLRSPVEFQDQFDVIVVGAGHAGCEAALATARLGCRTLLLTLNLDRIAWQPCNPAVGGP
AKSQLTHEVDALGGEIGKMADRTYLQKRVLNISRGPAVWALRAQTDKREYAAVMKNIVEN
QPNLSIREGMVTDLVLGDNDEIQGVQTYFGACFGAQSVVITTGTFLGGKIWIGNKSMPAG
RAGEFAAVGLTETLNELGFETGRLKTGTPARVDRRSVDYDKLEPQPPDEQVSWFSFDPEV
WVEREQMNCYLTRTTAKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESH
QIFIEPEGRDIPELYIQGFSTGLPENVQLAMLQTLPGLENCVMLRPAYAVEYDFLPATQC
YPSLMTKKVAGLFCAGQINGTTGYEEAAAQGLVAGINAARHCQGKSLIIFSREGSYLGTL
IDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWDLFQTKQANI
TAEKERLYSTRIKEQDAVGKEIVDYTQQKIKGSIVLAELLRRPGFHYPDLEKFQLGNEEL
KPEEKTSVEIEIKYSGYIKRQQTQIEQVSRHSQKRLPPGLNYMAIETLSMEAREKLTQFQ
PLTIGQAGRIGGVNPADINALLVYLETQLRRSVSP
Download sequence
Identical sequences L8ASQ1 Q55694
gi|383326336|ref|YP_005387189.1| SdR34 SgR67 gi|16331425|ref|NP_442153.1| gi|16331425|ref|NP_442153.1| 1148.sll0202 WP_010873451.1.11876 WP_010873451.1.1889 WP_010873451.1.18904 WP_010873451.1.33690 WP_010873451.1.35395 WP_010873451.1.47586 WP_010873451.1.99424 gi|383323167|ref|YP_005384020.1| gi|383492220|ref|YP_005409896.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]