SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383326464|ref|YP_005387318.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383326464|ref|YP_005387318.1|
Domain Number 1 Region: 396-640
Classification Level Classification E-value
Superfamily ThiG-like 1.14e-84
Family ThiG-like 0.000000337
Further Details:      
 
Domain Number 2 Region: 5-215,302-361
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.98e-43
Family FAD-linked reductases, N-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 210-301
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.83e-23
Family D-aminoacid oxidase-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383326464|ref|YP_005387318.1|
Sequence length 656
Comment ThiG protein [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MQTTSDVLIIGGGIIGLAIAVELKLKQKRLQVTVLSRDFAQAASHAAAGMLAPHAEQIAP
GPMLDLCLASRWRYGEWVEKLEQLTGMETGYNPCGILSPVFEAPHGNSSTNSAWLDQETI
RYYQPGLGEDVIGGWWHPDDGQVDNRKLVSALRQAAQSLGVQIQEGVTVQAIAQRHGQVT
AVLTDQGSFQADSYVLANGSWAKELLPLPVFPVKGQMMALRMPAGTHQPYPLQRVLFGPQ
TYLVPRRDGRLIVGATSEQVDWQPHNTPQGIQTLLGRAIRLFPALGDWAIEDFWWGFRPG
TPDEQPFLGYGPCDNLILAIGHYRNGILLAPITAALISDLILDQKVSPLIHAFSPQRFLT
TTNPPVLSCRPMTAVFPSIANPSLPHAAENSEGSKDLLEIAGRKFHSRLMTGTGKYPSLT
TMQESVASSGCQIVTVAVRRVQTNAPGHEGLAEAIDWSTIWMLPNTAGCQTAEEAIRVAR
LGREMAKLLGQEDNNFIKLEVIPDTQYLLPDPIGTLEAAEQLVKEGFAVLPYINADPLLA
KRLEEVGCATVMPLGSPIGSGQGIRNAANIGIIIENAKVPVVVDAGIGTPSEAAQAMEMG
ADAVLINSAIAMAANPVAMAQAMGMATQAGRLAYLSGRMPIKAKANASSPLTGLVG
Download sequence
Identical sequences Q55710
gi|383492348|ref|YP_005410025.1| SgR144 1148.slr0633 WP_010873578.1.11876 WP_010873578.1.1889 WP_010873578.1.18904 WP_010873578.1.33690 WP_010873578.1.35395 WP_010873578.1.47586 WP_010873578.1.99424 gi|16331553|ref|NP_442281.1| gi|383326464|ref|YP_005387318.1| gi|383323295|ref|YP_005384149.1| gi|16331553|ref|NP_442281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]