SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383326716|ref|YP_005387570.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383326716|ref|YP_005387570.1|
Domain Number 1 Region: 19-288
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-18
Family FAD-linked reductases, N-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383326716|ref|YP_005387570.1|
Sequence length 684
Comment hypothetical protein SYNPCCP_2638 [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MITYCRRTVAAIFLAIFSWPIAPGQTAPPRPVDKTVECEILIVGGGLAGTATAYEGLLAG
KNVCMTELTDWVGGQLTSQGTAALDERPTQTDKLFYPRGYLELRQRIKDFYGVQNPGKCW
VSRSSCFLPKDGHDILMAMLEDAEKKGQGTLQWFPNTVIKELVLAPTALGEAGEEIIQAI
AIQHQPAPNAPPLNSQFLSQTIEDSYRYEDSEQFTKTIINFTAPQSNQGRTAQWLVVEAT
ETGELIGLADVPYRVGVDPRTYLDPSSSSVEGFAYCTQGFTYTFAMEATTEPQPQPEPDF
YQRFTPYYSYDQSRFDFDALFTYRRIWSPDGLGIFEPATPNQPKNRFGVSPTQPGEISMQ
NWLPGNDYTPGTPRDNFVYTREQLQQTGQLEPGGWLGGLRTESLANGEKIALGFYHWLVA
GTTDAKLGDNVKTPNPNNRLLKGLDSPMGTEHGLSKFPYIREGRRIIGRPDFIYPNGFEI
NETDISRQDFKDDFYRENLSPRDYRRLHAELAGIDGLDVLDGSLSPDAVERRQRATMYPD
SVGIGHYNIDFHPCYLEYPVEKPGNIERPGERQAHTPSYPFQIPLRAMIPQRVDNLLVVG
KTIATSHIAAAAYRVHSFEWSSGAAAGIVAADALQNDYLPYQLVNQTALIANQKLLQLRR
KIDSTGNPTAFPNTSIFTSFENWK
Download sequence
Identical sequences Q55846
gi|383492600|ref|YP_005410277.1| 1148.sll0471 gi|383326716|ref|YP_005387570.1| WP_010873830.1.11876 WP_010873830.1.1889 WP_010873830.1.18904 WP_010873830.1.33690 WP_010873830.1.35395 WP_010873830.1.47586 WP_010873830.1.99424 gi|383323547|ref|YP_005384401.1| gi|16331804|ref|NP_442532.1| gi|16331804|ref|NP_442532.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]