SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383326832|ref|YP_005387686.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383326832|ref|YP_005387686.1|
Domain Number 1 Region: 4-259
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.38e-36
Family FAD-linked reductases, N-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  gi|383326832|ref|YP_005387686.1|
Domain Number - Region: 164-208,286-394
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00214
Family FAD/NAD-linked reductases, N-terminal and central domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383326832|ref|YP_005387686.1|
Sequence length 416
Comment hypothetical protein SYNPCCP_2754 [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MKKSHYSVIIVGGGQAGLAISYLLKQESIDHVIFEKNQIGHAWRNQRWDSFCLVTPNWQC
RLPGFPYAGGDDQGFMLKDEIVQYLEDYAASFQAPILEGVEVSKLSQRTDAFEVITSQGI
YTADQVVVATGGYHTPKIAAIAKKLPPHIVQLHSVDYKNPETLPDRILLVGTGQSGCQIA
EDLHLAGKTVHLATGSAPRSPRRYRGRDVVEWLELMGHYDLPIDEHPQKEMVRHKTNHYL
TGRDGGREIDLRQFALEGMHLYGRLKDIDGNQILFADNLKENLDQADATAARIKQSIDEY
IAKNQLDAPIEAPYQPVWEPTSIPLTLNIDEIDAVIWSTGFNFNYAWVDVPVFNSMGEPL
HNRGVTNVAGLYFLGLPWLYTWGSGRFSGVARDAEYLAEKIRETLPANQINPCTVA
Download sequence
Identical sequences L8AQI5 Q55951
gi|16331920|ref|NP_442648.1| SgR68 gi|383326832|ref|YP_005387686.1| 1148.slr0801 gi|383323663|ref|YP_005384517.1| gi|383492716|ref|YP_005410393.1| WP_010873946.1.11876 WP_010873946.1.1889 WP_010873946.1.18904 WP_010873946.1.33690 WP_010873946.1.35395 WP_010873946.1.47586 WP_010873946.1.99424 gi|16331920|ref|NP_442648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]