SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383326911|ref|YP_005387765.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383326911|ref|YP_005387765.1|
Domain Number 1 Region: 4-335,458-495
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.58e-64
Family FAD-linked reductases, N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383326911|ref|YP_005387765.1|
Sequence length 501
Comment hypothetical protein SYNPCCP_2833 [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MTVSPSYDAIVIGSGIGGLVTATQLVSKGLKVLVLERYLIPGGSAGYFEREGYRFDVGAS
MIFGFGDRGTTNLLTRALAAVGQALETLPDPVQIHYHLPGGLDPKVHREYEAFLQELIAK
FPQEAQGIRRFYDECWQVFNCLNTMELLSLEEPRYLMRVFFQHPGACLGLVKYLPQNVGD
IARRHIQDPDLLKFIDMECYCWSVVPADLTPMINAGMVFSDRHYGGINYPKGGVGQIAES
LVAGLEKFGGKIRYGARVTKIIQENNQAIGVELANGEKIYGRRIVSNATRWDTFGALTGD
QPLPGKEKRWRRNYQQSPSFLSLHLGVEADLLPEGTECHHILLEDWDDLEKEQGTIFVSI
PTLLDPSLAPDGYHIIHTFTPSWLESWQNLSPQEYEAKKEADSGKLIDRLEAIFPGLDRA
LDYMEIGTPRSHRRFLGRQNGTYGPIPRRRLPGLLPMPFNRTAIPGLYCVGDSTFPGQGL
NAVAFSGFACAHRLAVDLGVR
Download sequence
Identical sequences L8AQC5 Q55455
1148.sll0033 WP_010874022.1.11876 WP_010874022.1.1889 WP_010874022.1.18904 WP_010874022.1.33690 WP_010874022.1.35395 WP_010874022.1.47586 WP_010874022.1.99424 SgR71 gi|16331999|ref|NP_442727.1| gi|16331999|ref|NP_442727.1| gi|383492795|ref|YP_005410472.1| gi|383326911|ref|YP_005387765.1| gi|383323742|ref|YP_005384596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]