SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383327041|ref|YP_005387895.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383327041|ref|YP_005387895.1|
Domain Number 1 Region: 5-249,345-388
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.48e-59
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 223-342
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.89e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000473
Further Details:      
 
Domain Number 3 Region: 426-540
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 7.19e-28
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383327041|ref|YP_005387895.1|
Sequence length 553
Comment L-aspartate oxidase [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MGANQFDVVVVGSGAAGLYACLCLPGHYRVALVTKAELKTGASDWAQGGIAAAIAPTDSP
QSHYEDTLAAGAGLCDGEAVDFLVNHAPQAIAELVQFGVSFDRHGQHLALTLEAAHSQPR
VLHAADTTGRAIVSTLMGQVQARPNVEIFSQAIALSLNIEPTTGHCRGIQVFVNQTIETF
HSRAVLLATGGGGQVFAQTTNPKVSTGDGIALAWRSGAQVRDLEFFQFHPTALTKPGVPH
FLISEAVRGEGAHLLDRQGKRFAFDYHPRGELAPRDVVSRAIFQHLANTEKDPTQATVFL
DLSPIEPERIQRRFPNIIRRCLHWGVDIFREPIPVAPAAHYWMGGITTDINCQTTIPGLY
ALGETASTGVHGANRLASNSLLECIVFASQLRNLSLPPLASSDSNVNQSIKEIRLDTTND
LALLNHWRSELPRLMWQTAGICRQAETLQMAIAKLEQWQEQWQQLSSSKLLAHLPEDQKI
SLSGPGLNEFMQLWAETHNLLDIAQLILTSALFREESRGGHYRLDCPDTKREWQSHTVIE
GTRVFLQPSQSQD
Download sequence
Identical sequences L8AND0 P74562
gi|383323872|ref|YP_005384726.1| gi|383327041|ref|YP_005387895.1| gi|16332129|ref|NP_442857.1| gi|16332129|ref|NP_442857.1| gi|383492925|ref|YP_005410602.1| 1148.sll0631 WP_010874151.1.11876 WP_010874151.1.1889 WP_010874151.1.18904 WP_010874151.1.33690 WP_010874151.1.35395 WP_010874151.1.47586 WP_010874151.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]