SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383327236|ref|YP_005388090.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383327236|ref|YP_005388090.1|
Domain Number 1 Region: 13-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.4e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383327236|ref|YP_005388090.1|
Sequence length 326
Comment hypothetical protein SYNPCCP_3158 [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MKLSSKNLDARLDTVYDAIVLGGGMGGLSAAIYLARYGLKCLVVEKGRGRSFWMQDLRNY
VGLDPDTPGRDIITHSTQQALHWGADLLRGYVEDVTDEGDTLAVKVKVGKKDSLYPIFRT
KYVIAATGIIDNLPQLEDMQNVYDYAGYTLHVCMICDGFDMWDQKAVLIAGTEGQINAAF
VLNWFTPYITVLTHGLCTVGDEMKAKLADHGYPLHEAAITKFLGEDHKMSGVELVDGTVV
EATTGLINMGSVYHNHYLKGIEGLEWDGENLVTNDMAQTSHPRIFALGDLKKGLNQVSVA
VADGTLAATQIWRNIRRASEPRKWIH
Download sequence
Identical sequences L8ACA0 P74746
1148.slr0600 gi|383324067|ref|YP_005384921.1| gi|16332326|ref|NP_443054.1| gi|383493120|ref|YP_005410797.1| gi|16332326|ref|NP_443054.1| gi|383327236|ref|YP_005388090.1| WP_010874346.1.11876 WP_010874346.1.1889 WP_010874346.1.18904 WP_010874346.1.33690 WP_010874346.1.35395 WP_010874346.1.47586 WP_010874346.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]