SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383325158|ref|YP_005386011.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383325158|ref|YP_005386011.1|
Domain Number 1 Region: 309-359
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000497
Family HAMP domain 0.0023
Further Details:      
 
Domain Number 2 Region: 403-632
Classification Level Classification E-value
Superfamily PP2C-like 0.000000157
Family PP2C-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383325158|ref|YP_005386011.1|
Sequence length 634
Comment ICFG protein [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MKMKLIQPFIQSIRFRIVGLLLLCLIPPTLGGIFLIDSYTGRQLKKIAEQDLQSRARLII
QLISRSDRERQQSTAFVASQPAIVEFNVEASQYFLNEFIKFHQWNGFFVVANQEGELVAG
SDGANQEKGLPLKHWFEEVKDKNRHLNRLFPGKTYAESKDCLIVPIHSKNDQTQIGIVVE
CIPLPVIADFVQKILKDAELERILLVNYEGYIYADTDFKNYGVLENKKKSPLVNRLLNDQ
SGFVYSQGKFSYLSPVHLRGAKTWGLIVENSESDIQAAILNVNRIGYLLVLVIGGIVAYA
SWMVIHHSTVPILDLTKASQAIAAGDLDYEININQGNRQDEIGILGNSFIYMKNQIKTLI
AQEVKDGVNRLELEKGRQIQQNFLPISLPDLQQWQINAVFEPARSVSGDFYDAFLLGDDY
LAIVIGDVCDKGVGAAMFMGLFRSLLRVFSGETMPGDTCIRDVNYKCSANDGNGKKKVIV
QFLNAVRLTNDYIATEHGDMAMFATLFFGVIDISNGNLSYINAGHEPVFILNSEGIKHRL
KSTGPAVGMMPNSTFTIDSLKIDPGEMLIGYTDGVTDARSPTKEFFGRQRLMETLTANFS
AKTEILDIIKQELIGHIDGSIQFDDITMIAVYRN
Download sequence
Identical sequences L8AFC3 P37979
gi|383491042|ref|YP_005408718.1| gi|383321989|ref|YP_005382842.1| gi|383325158|ref|YP_005386011.1| 1148.slr1860 gi|16330246|ref|NP_440974.1| WP_010872284.1.11876 WP_010872284.1.1889 WP_010872284.1.18904 WP_010872284.1.33690 WP_010872284.1.35395 WP_010872284.1.47586 WP_010872284.1.99424 gi|16330246|ref|NP_440974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]