SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15896993|ref|NP_341598.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15896993|ref|NP_341598.1|
Domain Number 1 Region: 2-24,97-153
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000118
Family D-aminoacid oxidase, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15896993|ref|NP_341598.1|
Sequence length 183
Comment oxidoreductase, soxB-like, (soxB-like) [Sulfolobus solfataricus P2]
Sequence
MIILSAGAWSKYLINVKLPVKTYYCWASLFLSKKKEVGSNIIYDYVNNFYSRPVIGLGFP
LAIMGDGKAIETTPLQQNICIEDKNEVSARISRRLGEVKELYTSGSFCEATPDMRPAYGK
IAENVYFIGGFNGYGAEVGPGLAHVLVEEILSKKEDTYFTEYRLERLNGYDGNFEIGQEP
HEL
Download sequence
Identical sequences Q981C4
gi|15896993|ref|NP_341598.1| 273057.SSO0021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]