SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15897142|ref|NP_341747.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15897142|ref|NP_341747.1|
Domain Number - Region: 68-120
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0455
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15897142|ref|NP_341747.1|
Sequence length 228
Comment hypothetical protein SSO0191 [Sulfolobus solfataricus P2]
Sequence
MRIISIKLTDEEYKELEERARREGFVLLSDFVKSLLFSSSYPHGTQVDNAQVVSRIEKKM
QDMINPFTSQIDEIKQKVAMLTERIEILEEKLGESKDNMKDINKKQKKSFESKSINVKSE
PQHKKTAIDILREQGVIYESELKLNNPDAFFDKLETQGAIVITTDPERIAIDSNFYEEFK
KKIANISTSDEIEVQKYLTKQEYKLFQKLRQYSVIYFDADSKSWKFVS
Download sequence
Identical sequences A0A0E3MFJ1 D0KRP1 Q980T6
WP_009990429.1.14611 WP_009990429.1.22626 WP_009990429.1.43719 WP_009990429.1.57434 WP_009990429.1.66040 WP_009990429.1.8449 WP_009990429.1.93834 gi|384433653|ref|YP_005643011.1| gi|15897142|ref|NP_341747.1| 273057.SSO0191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]