SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15897860|ref|NP_342465.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897860|ref|NP_342465.1|
Domain Number 1 Region: 1-68,150-320
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 3.11e-74
Family Pyruvate kinase 0.000028
Further Details:      
 
Domain Number 2 Region: 302-447
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.11e-27
Family Pyruvate kinase, C-terminal domain 0.0091
Further Details:      
 
Domain Number 3 Region: 63-149
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 2.62e-17
Family Pyruvate kinase beta-barrel domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15897860|ref|NP_342465.1|
Sequence length 452
Comment pyruvate kinase (pyK) [Sulfolobus solfataricus P2]
Sequence
MRKTKIVATLGPSSEEKVKELAEYVDVFRINFAHGDETSHRKYFDLIRTYAPESSIIVDL
PGPKLRLGELKEPIEVKKGDKIVFSQKDGIPVDDELFYSAVKENSDILIADGTIRVRVKS
KAKDRVEGTVIEGGILLSRKGINIPNVNLKSGITDNDLKLLKRALDLGADYIGLSFVISE
NDVKKVKEFVGDEAWVIAKIEKSEALKNLTNIVNESDGIMVARGDLGVETGLENLPLIQR
RIVRTSRVFGKPVILATQVLTSMINSPIPTRAEIIDISNSIMQGVDSIMLSDETAIGNYP
VESVRTLHNIISNVEKSVKHRPIGPLNSESDAIALAAVNASKVSKADVIVVYSRSGNSIL
RVSRLRPERNIIGVSPDPRLAKKFKLCYGVIPISINKKMQSIDEIIDVSAKLMQEKIKDL
KFKKIVIVGGDPKQEAGKTNFVIVKTLEQQKK
Download sequence
Identical sequences A0A157SZY8 Q97ZD7
WP_010923158.1.43719 WP_010923158.1.8449 gi|15897860|ref|NP_342465.1| 273057.SSO0981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]