SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15897954|ref|NP_342559.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897954|ref|NP_342559.1|
Domain Number 1 Region: 68-206
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.42e-24
Family FHA domain 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|15897954|ref|NP_342559.1|
Domain Number - Region: 2-31
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00139
Family Ran binding protein zinc finger-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15897954|ref|NP_342559.1|
Sequence length 209
Comment hypothetical protein SSO1088 [Sulfolobus solfataricus P2]
Sequence
MTWRCPVCGYENADDSLFCIKCGTKKPEQQVEQPPAPPVEQQASGQQSVEQQPADQNQLS
QQSATSEQQPVTEQQAPQQVVVEQPSETAKTEQPQSATTTVSKYYLLFINTPNPAFNKTK
LPLDFDIFPSISIGRSPENVIVIPDPEVSRKHAIISFENNELYLEDLNSTNGTYVYDGKV
FQPVKGKIKVQHNSIIKLGNNTVVRIVGE
Download sequence
Identical sequences A0A0E3MGU6 D0KU50 Q97Z47
gi|15897954|ref|NP_342559.1| WP_009989723.1.14611 WP_009989723.1.22626 WP_009989723.1.43719 WP_009989723.1.57434 WP_009989723.1.66040 WP_009989723.1.8449 WP_009989723.1.93834 gi|384434512|ref|YP_005643870.1| 273057.SSO1088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]