SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15897971|ref|NP_342576.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897971|ref|NP_342576.1|
Domain Number 1 Region: 23-104
Classification Level Classification E-value
Superfamily SirA-like 3.14e-17
Family SirA-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15897971|ref|NP_342576.1|
Sequence length 121
Comment hypothetical protein SSO1109 [Sulfolobus solfataricus P2]
Sequence
MCIQLQIAYCILGIRPSCCQNKIFYLYNVNSLTMIEEMDLTPLECPEPFMKVVAKLMKIE
NGELKIRYKDPKCREMLLEAMKLMNCKVLEDSQNNGVFFMHIKKESGSSEKPKKIELTGG
C
Download sequence
Identical sequences A0A157T048 Q97Z31
gi|15897971|ref|NP_342576.1| 273057.SSO1109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]