SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898018|ref|NP_342623.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898018|ref|NP_342623.1|
Domain Number 1 Region: 14-236
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.36e-45
Family Bacterial glucoamylase C-terminal domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898018|ref|NP_342623.1|
Sequence length 270
Comment hypothetical protein SSO1163 [Sulfolobus solfataricus P2]
Sequence
MKYQIKEITESNYHLLPQDLSVWEDRDAYHFWTEAFNVLGLQSVAEIYKALNFSNYTIVL
NYEKELNQSILKNFWNNDYFASALGVSVIFEGGKSESILTPEPPSVDSATLLPIDFGYLP
PTSNYSISNFKLVNRTLFLTGGLARFPNDMYHYSQSLYDASAPEPPWMITTFFEALYLEE
LGKSNEALNLMYWAYNHSQHGLLPEAIDPKYAYPLPTTSPLTWSSAMFVITALNYKPPSE
SQSVSPLLYVIIVIILATIVITVISVLRRR
Download sequence
Identical sequences A0A0E3JUI6 Q97YY7
gi|15898018|ref|NP_342623.1| WP_009991579.1.14611 WP_009991579.1.22626 WP_009991579.1.43719 WP_009991579.1.57434 WP_009991579.1.66040 WP_009991579.1.8449 WP_009991579.1.93834 273057.SSO1163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]