SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898041|ref|NP_342646.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15898041|ref|NP_342646.1|
Domain Number - Region: 42-110
Classification Level Classification E-value
Superfamily OmpH-like 0.00405
Family OmpH-like 0.026
Further Details:      
 
Domain Number - Region: 329-362
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0612
Family PhnA zinc-binding domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898041|ref|NP_342646.1|
Sequence length 393
Comment transposase ISC1316 [Sulfolobus solfataricus P2]
Sequence
MPTLGFRFRAYTDEQTLRALKAQLKLTCEIYNTLRWADIYFYQRDGKGLTQTELRQLALD
LRKQDDEYKQLYSQVVQQVADRYSEAKKRFFEGLARFPKEKKPHKYYSLVYTQSGWKILH
VREIRKGKKNKKKLITLKLSNLGTFKVIVHRDFPLDKVKRVVVKLTRSERIYITFVVDHE
FPKLPNTGKVVAIDVGVEKLLITSDGEYFPNLRPYEKALWKVKHIHRELSRKKFLSNNWF
KAKVKLARAYEHLKNLRTDLYMKLGKWFAEHYDVVVMEGIHAKQLVGKSLRSLRRRLSDV
GFGELRGVLKYQLEKYGKKLILVNPAYTSKTCARCGYVKNDLSLSDRVFVCPNCGWIADR
DYNASLNILRGSGSERPLVWSSALYQYSGKVGL
Download sequence
Identical sequences A0A0E3MCK4 D0KUF9 Q97YW4
WP_010923235.1.14611 WP_010923235.1.22626 WP_010923235.1.43719 WP_010923235.1.66040 WP_010923235.1.8449 WP_010923235.1.93834 273057.SSO1187 SsR46 gi|15898041|ref|NP_342646.1| gi|384434599|ref|YP_005643957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]