SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898157|ref|NP_342762.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15898157|ref|NP_342762.1|
Domain Number - Region: 23-94
Classification Level Classification E-value
Superfamily OmpH-like 0.00589
Family OmpH-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898157|ref|NP_342762.1|
Sequence length 181
Comment transposon ISC1316 Orf1 [Sulfolobus solfataricus P2]
Sequence
MRALKAQLRLACEVYNTLRWADTYFYQRDGKGLTQTELRQMALDLRKQDEEYKQLHSQVV
QQIVDRFYEAKKRFMDGLARFPREKKPHKYYSLVYSQSGWKVLSLREIRRKSNHKKKLMK
LYLSHLGVFNVIVHRDFPLDKVKRIIVKLEPSGRIYIIFVVDYEFKALPSTWKSCRDRRG
N
Download sequence
Identical sequences Q97YK7
361214 273057.SSO1316 gi|15898157|ref|NP_342762.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]