SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898182|ref|NP_342787.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15898182|ref|NP_342787.1|
Domain Number - Region: 42-110
Classification Level Classification E-value
Superfamily OmpH-like 0.00131
Family OmpH-like 0.026
Further Details:      
 
Domain Number - Region: 327-360
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0663
Family PhnA zinc-binding domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898182|ref|NP_342787.1|
Sequence length 403
Comment transposase ISC1316 [Sulfolobus solfataricus P2]
Sequence
MPTLGFRFRAYTDEQTLRALKAQLKLACKIYNTLRWADIYFYQRDGKGLTQTELRQLALD
LRKQDDEYKQLYSQVVQQIADRYYEARQRFFEGLARFPKEKKPHKYYSLVYPQYGWKILH
VREIRKGSKKKLITLKLSNLGTFKVIVHRDFPLDKVKRVVVKLTRSERIYITFVVDHEFP
KLPNTGKVVAIDVGVEKLLVTSDGEYFPNLRPYEKALWKVKHLHRELSRKKFLSNNWFKA
KVKLARAYEYLKNLRTDLYMKLGKWFAEHYDVVVMEGIHAKQLVGKSLRSLRRRLSDVGF
GELRGVLKYQLEKYGKKLILVNPAYTSKTCARCGYVKNDLSLSDRVFVCPNCGWIADRDY
NASLNILRGSGSERPLVPVELRPLPVLWQGGAMKQEAPSFMRG
Download sequence
Identical sequences Q97YI2
SsR50 WP_010923334.1.8449 gi|15898182|ref|NP_342787.1| 273057.SSO1341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]