SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898243|ref|NP_342848.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898243|ref|NP_342848.1|
Domain Number 1 Region: 34-117
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000144
Family HD domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898243|ref|NP_342848.1|
Sequence length 214
Comment hypothetical protein SSO1403 [Sulfolobus solfataricus P2]
Sequence
MTCWAFYGMETFKQHSLGILNFFRDNFSYIIPIISYRTGIDKETVRKSVEIGVSLHDIGK
TSKYYDMSYFGHEFYSGYLVYKILRECCDSELKPLIALAAMSHHQGMEGRTLNEMILKGN
YTRIPSFYELREECRNDIVEILGEIGVKVKDFPQKVTRSDVKSWFQKLNIKWKNLYVIIL
GPLMISDTVVANKNRGGDQYNKIIEEYEKWINVK
Download sequence
Identical sequences A0A0E3MDD8 D0KV47 Q97YC3
gi|384434704|ref|YP_005644062.1| 377882 273057.SSO1403 WP_009988400.1.14611 WP_009988400.1.22626 WP_009988400.1.43719 WP_009988400.1.57434 WP_009988400.1.66040 WP_009988400.1.8449 WP_009988400.1.93834 gi|15898243|ref|NP_342848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]