SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898332|ref|NP_342937.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15898332|ref|NP_342937.1|
Domain Number - Region: 19-110
Classification Level Classification E-value
Superfamily OmpH-like 0.00124
Family OmpH-like 0.029
Further Details:      
 
Domain Number - Region: 326-355
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0589
Family Rubredoxin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898332|ref|NP_342937.1|
Sequence length 391
Comment transposase ISC1316 [Sulfolobus solfataricus P2]
Sequence
MPTLGFRFRAYTDEQTLRALKAQLKSACKIYNTLRWADIYFYQRDGKGLTRTELRQLALD
LRKQDDEYKQLYSQVVQQVADRYYEAKKRFFEGLAHFPKEKKPHKHYSLVYPQYGWKILQ
VREIRKGSKKKLITLKLSNLGTFKVIVHRDFPLDKVKRVVVKLTRSERIYITFVVDHEFP
KLPNTGKVVAIDVGVEKLIVTSDGEYFPNLRPYEKALWKVKHLHRELSRKKFLSHNWFKA
KVKLARAYEYLKNLRTDLYMKLGKWFAEHYDVVVMEGIHVKQLIGKSLRSLRRRLSDVAF
SELRDLIKYQLEKYGKKLILVNPAYTSKTCAKCGYVKEDLSLSDRVFVCPNCGWIADRDY
NASLNILRGSGSERPLVWSSALYQYSGMAEL
Download sequence
Identical sequences A0A157T179 Q97Y44
WP_010923437.1.43719 WP_010923437.1.8449 273057.SSO1504 gi|15898332|ref|NP_342937.1| SsR45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]