SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898414|ref|NP_343019.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898414|ref|NP_343019.1|
Domain Number 1 Region: 7-116,157-285
Classification Level Classification E-value
Superfamily Aquaporin-like 4.84e-47
Family Aquaporin-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898414|ref|NP_343019.1|
Sequence length 289
Comment transposon ISC1229 Orf1 [Sulfolobus solfataricus P2]
Sequence
MSVVLKDSLWRYFAEFVGTFILILFGDGAIVASTLSSQPSFGFIMVSWGFGIVLAIYAVG
PISGAHINPNVTLAFAVTKRIKWVDVIPYIVFQILGAAAATSVLLVWWGDVITRIDPPPF
LYADIGAAFFTQYPEPGFWPQYWPKSYLPNVSSAGILYSQVNQIFPLWKGAFAEALMTFL
LLLIVVAVTDPDSPFYSQSLAPWAIGIGYVMPFLLFEAQLTGGMINEARSWGPMLALYLF
GYRTGAFNFRGEYFYVYGIPDFIGGILGALFWDHVLKPYLRFVKNINKK
Download sequence
Identical sequences A0A157T1I3 Q97XW0
gi|15898414|ref|NP_343019.1| 273057.SSO1601 WP_010923498.1.43719 WP_010923498.1.8449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]