SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898487|ref|NP_343092.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15898487|ref|NP_343092.1|
Domain Number - Region: 42-110
Classification Level Classification E-value
Superfamily OmpH-like 0.000902
Family OmpH-like 0.031
Further Details:      
 
Domain Number - Region: 326-355
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0612
Family Rubredoxin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898487|ref|NP_343092.1|
Sequence length 395
Comment transposase ISC1316 [Sulfolobus solfataricus P2]
Sequence
MPTLGFRFRAYTDEQTLRALKAQLKLACKIYNTLRWADIYFYQRDGKGLTQTELRQLALD
LRKQDDEYKKLYSQVVQQIADRYYEARQRFFDGLARFPKERKPHKYYSLVYTQSGWKILQ
VREIRKGSKKKLITLKLSNLGTFKVIVHRDFPLDKVKRVIVKLTRSERIYITFVVDHEFP
KLPNTGKVVAIDVGVEKLLVTSDGEYFPNLRPYEKALWKVKHLHRELSRKKFLSNNWFKA
KVKLARAYEYLKNLRTDLYMKLGKWFAEHYDVVVMEDIHVKQLIGKSLRSLRRRLSDVAF
SELRDLIKYQLEKYGKKLILVNPAYTSKTCAKCGYVKEDLSLSDRVFVCPNCGWIADRDY
NASLNILRGSGSERPLVWSSALYQYQHFGTGMAEL
Download sequence
Identical sequences A0A157T284 Q97XP1
SsR47 WP_010923558.1.8449 273057.SSO1672 gi|15898487|ref|NP_343092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]