SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898643|ref|NP_343248.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15898643|ref|NP_343248.1|
Domain Number - Region: 16-87
Classification Level Classification E-value
Superfamily OmpH-like 0.00183
Family OmpH-like 0.026
Further Details:      
 
Domain Number - Region: 309-341
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0485
Family Transcriptional factor domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898643|ref|NP_343248.1|
Sequence length 376
Comment transposase ISC1316 [Sulfolobus solfataricus P2]
Sequence
MKLACKIYNTLRWADIYFYQRDGKGLTQTELRQLALDLRKQDDEYKQLYSQVVQQIADRY
YEARQRFFEGLARFPKEKKPHKYYSLVYPQYGWKILQVREIRKGSKKNKKRLITLKLSNL
GTFKVIIHRDFPLDKVKRVVVKLTRSERIYITFVVEDYEFPKLPNTGKVVAIDVGIEKLI
VTSDGEYFPNLRPYEKALWKVKHLHRELSRKKFLSNNWFKAKVKLARAYEHLKNLRTDLY
MKLGKWFAEHYDVVVMEDIHVKQLIGKSLRSLRRRLSDVAFSELRDLIKYQLEKYGKKLI
LVNPAYTSKTCARCGYVKEDLSLSDRVFVCSNCGWIADRDYNASLNILRGSGSERPLVWS
SALYQYQHFGTGMAEL
Download sequence
Identical sequences Q97XA4
273057.SSO1844 SsR43 gi|15898643|ref|NP_343248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]