SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898679|ref|NP_343284.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898679|ref|NP_343284.1|
Domain Number 1 Region: 9-74
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 5.89e-17
Family HEPN domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898679|ref|NP_343284.1|
Sequence length 91
Comment hypothetical protein SSO9136 [Sulfolobus solfataricus P2]
Sequence
MSGNRVRLFKRRALRFLDEAKRDLNEGYYDIGSFHVEQALQLYIKAVIFELFGKEYEGHG
IRELLGYLSKLLKENEYEELAKKVNERVSGM
Download sequence
Identical sequences A0A0E3GX41 D0KP85 Q97X68
gi|15898679|ref|NP_343284.1| WP_010923638.1.14611 WP_010923638.1.22626 WP_010923638.1.43719 WP_010923638.1.66040 WP_010923638.1.8449 WP_010923638.1.93834 273057.SSO9136 gi|384435015|ref|YP_005644373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]