SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898907|ref|NP_343512.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15898907|ref|NP_343512.1|
Domain Number - Region: 42-110
Classification Level Classification E-value
Superfamily OmpH-like 0.00068
Family OmpH-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898907|ref|NP_343512.1|
Sequence length 287
Comment transposon ISC1316 Orf1, partial [Sulfolobus solfataricus P2]
Sequence
MPTLGFRFRAYADEQTLRALKAQLKLACKIYNTLRWADIYFYQRDGKGLTQTELRQLALD
LRKQDDEYKQLYSQVVQQIADRYYEAKKRFFEGLARFPKEKKPHKHYSLVYTQSGWKILH
VREIRKGKKKLITLKLSNLGTFKVIIHRDFPLDKVKRVIVKLTRSERIYITFVVDHEFPK
LPNTGKEVAIDVGVEKLLVTSDGEYFPNLRPLEKALWKVKHLHRELSRKKFLSHNWFKAK
VKLARAYEHLKNLRTDLYMKLGKWFAEHYDVVVMEGIHAKQLVWVSP
Download sequence
Identical sequences P95897 Q7LX75
273057.SSO2123 gi|15898907|ref|NP_343512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]