SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15899125|ref|NP_343730.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15899125|ref|NP_343730.1|
Domain Number - Region: 54-96
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0258
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15899125|ref|NP_343730.1|
Sequence length 104
Comment hypothetical protein SSO2369 [Sulfolobus solfataricus P2]
Sequence
MDSGITIIAEKLIDPSVKKACKMMVKDDEIIKLVGISSKKLALNVIDKVSFWLVYENNNL
LYCKLCNRGPFTKKGLYLHLSRVHRREIREMLEEELRHEIRTII
Download sequence
Identical sequences A0A0E3GUC2 D0KV06 Q97W68
gi|15899125|ref|NP_343730.1| WP_009989474.1.14611 WP_009989474.1.22626 WP_009989474.1.43719 WP_009989474.1.57434 WP_009989474.1.66040 WP_009989474.1.8449 WP_009989474.1.93834 273057.SSO2369 gi|384432720|ref|YP_005642078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]