SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15899355|ref|NP_343960.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899355|ref|NP_343960.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily SirA-like 0.0000000000000392
Family SirA-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899355|ref|NP_343960.1|
Sequence length 77
Comment hypothetical protein SSO10788 [Sulfolobus solfataricus P2]
Sequence
MSSLKIYKELDLTSSSCAGPIGELSSVIDELRDGEAVKVILGDEATKKDITLWSKKKGLK
IVQESQEGSKYVLLISK
Download sequence
Identical sequences A0A0E3GTT8 D0KNV3 Q97VJ4
WP_009992171.1.14611 WP_009992171.1.22626 WP_009992171.1.43719 WP_009992171.1.57434 WP_009992171.1.66040 WP_009992171.1.8449 WP_009992171.1.93834 gi|384432966|ref|YP_005642324.1| gi|384434617|ref|YP_005643975.1| 273057.SSO10788 gi|15899355|ref|NP_343960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]