SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15899503|ref|NP_344108.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15899503|ref|NP_344108.1|
Domain Number - Region: 42-110
Classification Level Classification E-value
Superfamily OmpH-like 0.0017
Family OmpH-like 0.026
Further Details:      
 
Domain Number - Region: 328-361
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0383
Family Transcriptional factor domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15899503|ref|NP_344108.1|
Sequence length 399
Comment transposase ISC1316 [Sulfolobus solfataricus P2]
Sequence
MPTLGFRFRAHTDEQTLRALKAQLKLACEVYNTLRWADIYFYQRDGKGLTQTELRQLALD
LRKQDDEYKQVYSQVVQQIADRYYEARQRFFEGLARFPKEKKPHKYYSLVYPQYGWKILQ
VREIRKGSKKKLITLKLSNLGVFKVIVHRDFPLDKVKRVVVKLTRSERIYITFVVEGYEF
PKLPNTGKVVAIDVGVEKLLVTSDSEYFPNLRPLEKALWKVKHLHRELSRKKFLSNNWFK
AKVKLARAYEHLKNLRTDLYMKLGKWFAEHYDVVVMEDIHVKQLIGKSLRSLRRRLSDVA
FSELRDLIKYQLEKYGKKLILVNPAYTSKTCARCGYVKEDLSLSDRVFVCSNCGWIADRD
YNASLNILRGSGSERSLVPVELRPLPVPALRYWHGRAVK
Download sequence
Identical sequences Q97V47
gi|15899503|ref|NP_344108.1| SsR48 273057.SSO2785 WP_010923968.1.8449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]