SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15899504|ref|NP_344109.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15899504|ref|NP_344109.1|
Domain Number 1 Region: 132-193
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000589
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.002
Further Details:      
 
Weak hits

Sequence:  gi|15899504|ref|NP_344109.1|
Domain Number - Region: 32-76
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0759
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899504|ref|NP_344109.1|
Sequence length 205
Comment hypothetical protein SSO2786 [Sulfolobus solfataricus P2]
Sequence
MAKSTTTKVGNAIVRTIIYIILYVILSAIVKYIIESLLPSFNIHAVSYESYVQILLALAF
GYLIVSGISLIFYYSLLPKYGHPTAAAVRNIMRIIGIGALAASIAGAVAGGAAGVALGGF
IGIVIGFASQQVLGQAVAGLFLLVARPFKVNDNVNIVSEDGIVEDVSTLFTTILKADGTR
VLIPNNMIIGNKIYLKQTEQQQKPQ
Download sequence
Identical sequences A0A0E3MHW8 D0KPN3 Q97V46
WP_009991934.1.14611 WP_009991934.1.22626 WP_009991934.1.57434 WP_009991934.1.66040 WP_009991934.1.8449 WP_009991934.1.93834 gi|15899504|ref|NP_344109.1| gi|384433120|ref|YP_005642478.1| 273057.SSO2786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]