SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15899920|ref|NP_344525.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15899920|ref|NP_344525.1|
Domain Number - Region: 16-67
Classification Level Classification E-value
Superfamily OmpH-like 0.000523
Family OmpH-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15899920|ref|NP_344525.1|
Sequence length 68
Comment transposon ISC1316 Orf1, partial [Sulfolobus solfataricus P2]
Sequence
MKLACKIYNTLRWADIYFYQRDGKGLTQTELRQLALDLRKQDDEYKQLYSQVVQQIADRY
YEARQRFF
Download sequence
Identical sequences Q97U08
gi|15899920|ref|NP_344525.1| 273057.SSO12210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]