SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO0621 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO0621
Domain Number 1 Region: 9-158
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.93e-26
Family Single-domain sulfurtransferase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO0621
Sequence length 194
Comment (Streptomyces coelicolor)
Sequence
MNTPAATATALTTGQAAARLAEFTVVDVRSPGEFAGGHLPGAHNVPLERLDEAAGTLAAA
AARGPLLLVCASGNRSAKGCARLAARDVAAATLEGGTSAWAAAGHPVERPAGARTPWPMD
RQVRLAAGSLVAAGFVAGRFWRPAHWLSGAIGAGLVFSGVTNTCGMAAALARLPHNRPTG
DVASFEETLARLAA
Download sequence
Identical sequences A0A076MG29 A0A1H1T1C6 Q9RD61
100226.SCO0621 NP_624932.1.49638 WP_011027252.1.26049 WP_011027252.1.58943 gi|21219153|ref|NP_624932.1| RR493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]