SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO1069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO1069
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.5e-27
Family MarR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO1069
Sequence length 159
Comment (Streptomyces coelicolor)
Sequence
MGVHGGKSPGAAAFRQRGVRRAELCYGARMAAKKAEQALVNRWRSILVLHARVQCELDRA
LHGHGLCGSDFEVLDVLAGTPDEDGSCGYRVQQISERVHLSQSALSRLVARLEKDGLVER
SLCPEDRRGVRVALTPKGRARHGEALPVQRAVLHRMLAG
Download sequence
Identical sequences Q9K430
gi|21219584|ref|NP_625363.1| NP_625363.1.49638 100226.SCO1069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]