SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO2073 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO2073
Domain Number 1 Region: 82-309
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.93e-68
Family Pseudouridine synthase RsuA/RluD 0.0000107
Further Details:      
 
Domain Number 2 Region: 19-107
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000000236
Family Pseudouridine synthase RsuA N-terminal domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO2073
Sequence length 314
Comment (Streptomyces coelicolor)
Sequence
MSTIPEIRTLPVPDGLEGERVDAAISRMFGFSRTKAAELAAAGKVQVDGSVVGKSERVHG
GAWLEVEMPQAPAPVQVVAEPVEGMEIVHDDEDVVVVVKPVGVAAHPSPGWSGPTVIGGL
AAAGYRVSTSGAAERQGIVHRLDVGTSGLMAVAKSERAYTSLKRQFKERTVDKRYHTLVQ
GHPDPTSGTIDAPIGRHPQHDYKWAVTAEGKPSVTHYDLIEAFRAASLLDVKLETGRTHQ
IRVHMAAHRHPCVGDLTYGADPTLAKRLRLTRQWLHAVRLGFEHPGTGDWVEYASEYPDD
LQQALDLVREETYG
Download sequence
Identical sequences Q9S2X8
100226.SCO2073 NP_626332.1.49638 WP_003976742.1.26049 WP_003976742.1.30910 WP_003976742.1.43399 WP_003976742.1.55229 WP_003976742.1.58943 WP_003976742.1.86682 gi|21220553|ref|NP_626332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]