SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO2292 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO2292
Domain Number 1 Region: 44-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.17e-79
Family Xylanase/endoglucanase 11/12 0.0000000189
Further Details:      
 
Domain Number 2 Region: 247-335
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.02e-16
Family Cellulose-binding domain family II 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO2292
Sequence length 335
Comment (Streptomyces coelicolor)
Sequence
MNLLVQPRRRRRGPVTLLVRSAWAVALAALAALMLPGTAQADTVVTTNQEGTNNGYYYSF
WTDSQGTVSMNMGSGGQYSTSWRNTGNFVAGKGWANGGRRTVQYSGSFNPSGNAYLALYG
WTSNPLVEYYIVDNWGTYRPTGEYKGTVTSDGGTYDIYKTTRVNKPSVEGTRTFDQYWSV
RQAKRTGGTITTGNHFDAWARAGMPLGNFSYYMIMATEGYQSSGSSSINVGGTGGGDNGG
GDNGGGGGGCTATVSAGQKWGDRYNLDVSVSGASDWTVTMNVPSPAKVLSTWNVNASYPS
AQTLTARSNGSGNNWGATIQANGNWTWPSVSCSAG
Download sequence
Identical sequences Q9RKN6
100226.SCO2292 gi|21220761|ref|NP_626540.1| NP_626540.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]