SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO3205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO3205
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.69e-28
Family MarR-like transcriptional regulators 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO3205
Sequence length 163
Comment (Streptomyces coelicolor)
Sequence
MNDEPRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYYGLLVKLAESPRRRLR
MTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAILTDEGYEVLRRTAPGHV
DAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQPSEAGADLPWLR
Download sequence
Identical sequences A0A076MCC2 A0A1H2BBM5 Q9KYU1
100226.SCO3205 gi|21221640|ref|NP_627419.1| NP_627419.1.49638 WP_011028826.1.26049 WP_011028826.1.30910 WP_011028826.1.43399 WP_011028826.1.55229 WP_011028826.1.58943 WP_011028826.1.86682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]