SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO3497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO3497
Domain Number 1 Region: 38-259
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.3e-71
Family Alginate lyase 0.00000000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO3497
Sequence length 259
Comment (Streptomyces coelicolor)
Sequence
MSRTRKRTLATTGVAALSALAALTLPLVTGGTATAAAPCDYPAQQLNLTNWKVTLPTGSS
GSPTEVKQPSLATFSASPWFTVNSACTGVQFRSAVNGVTTSGSSYARSELREMTSNGTKN
ASWSATSGTHTMTFREAFNKLPNDKPHVVGAQIHDGDDDVTVFRLEGTSLYITKGNDTHH
KLVTSNYKLNTVFEGKFVVSGGQIKAYYNGVLQTTIAHSASGNYFKAGGYTQANCGNSSP
CSSSNYGQVSVYKLLVNHS
Download sequence
Identical sequences Q9RKE1
gi|21221919|ref|NP_627698.1| 100226.SCO3497 NP_627698.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]