SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO4723 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO4723
Domain Number 1 Region: 1-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.61e-44
Family Nucleotide and nucleoside kinases 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO4723
Sequence length 217
Comment (Streptomyces coelicolor)
Sequence
MRIVLVGPPGAGKGTQATRLAETLHIPHISTGDLFRANISQQTELGKLAKSYMNAGNLVP
DEVTIAMAKDRMEQPDAEGGFLLDGFPRNVSQAEALDELLETEGMKLDAVLDLEAPEDEV
VKRIAGRRVCRNEPKHVFHVTYTPPKKEGVCDVCGGELYQRDDDSEETVRKRLEVYHTQT
EPIIDYYKSQGLVATIAATGPVDEVTRRALEALKRDQ
Download sequence
Identical sequences P43414
NP_733646.1.49638 100226.SCO4723 gi|32141245|ref|NP_733646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]