SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO4868 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO4868
Domain Number 1 Region: 166-280
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 9.94e-23
Family L,D-transpeptidase catalytic domain-like 0.0026
Further Details:      
 
Domain Number 2 Region: 69-140
Classification Level Classification E-value
Superfamily PGBD-like 1.88e-16
Family Peptidoglycan binding domain, PGBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO4868
Sequence length 281
Comment (Streptomyces coelicolor)
Sequence
MRMTGMGSTGRVVAVALGAVLVAGGCTVQGTGPDGRGRAPVRIEVTGHPPKSTPAPDRHR
PSSAPPAAPAAARVLWKRGDTGRDVRELQARLRQVEWLVDGPTGTYDDLTERAVSGFQGK
RGLPRTGRTDTVTWQRLLGMSHEPGKWDLYLMGGQPAAAPDPRCTSGRVLCVSKSSRTLR
WMIDGRTVSTMSVRFGSQYTPTREGVFQVYWKSRHHVSTLYDSAMPYAMFFSGGQAVHYS
YDFAARGYAGASHGCVNVRDEAAIADLYAQVKTGDKVVVYQ
Download sequence
Identical sequences Q9EWD9
100226.SCO4868 NP_629022.1.49638 gi|21223243|ref|NP_629022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]