SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO5434 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO5434
Domain Number 1 Region: 7-134
Classification Level Classification E-value
Superfamily CheY-like 1.99e-31
Family CheY-related 0.0028
Further Details:      
 
Weak hits

Sequence:  100226.SCO5434
Domain Number - Region: 177-214
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000166
Family FaeA-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO5434
Sequence length 230
Comment (Streptomyces coelicolor)
Sequence
MSTADSQPIRVLVVEDDPVAADAHVMYVGRVPGFVAVGKAHTGAEARRMLDRTPVDLLLL
DLHLPDVHGLQLARSLRAAGHHTDVIAVTSARDLTMVREGVSLGVVQYVLKPFTFATLRD
RLVRYAEFRGTAGEASGQDEVDRALATLRAPGPAALPKGLSGPTLERVTGALRGATEGLT
AAGVAEAVGISRITARRYLEHLVDAGRAGRSPQYGQVGRPELVYRWVRGR
Download sequence
Identical sequences Q9L1L0
gi|21223793|ref|NP_629572.1| NP_629572.1.49638 100226.SCO5434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]