SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO5737 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO5737
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-46
Family Ribonuclease PH domain 1-like 0.0000000821
Further Details:      
 
Domain Number 2 Region: 322-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.19e-41
Family Ribonuclease PH domain 1-like 0.000000258
Further Details:      
 
Domain Number 3 Region: 152-260
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.78e-29
Family Ribonuclease PH domain 2-like 0.00000116
Further Details:      
 
Domain Number 4 Region: 474-573
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.8e-24
Family Ribonuclease PH domain 2-like 0.00000624
Further Details:      
 
Domain Number 5 Region: 581-668
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.08e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 6 Region: 265-344
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.12e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000151
Further Details:      
 
Domain Number 7 Region: 646-720
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000032
Family Cold shock DNA-binding domain-like 0.0000754
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO5737
Sequence length 739
Comment (Streptomyces coelicolor)
Sequence
MENETHYAEAVIDNGAFGTRTIRFETGRLARQAAGSAVAYLDDDTMVLSATSASKNPKDQ
LDFFPLTVDVEERMYAAGKIPGSFFRREGRPSEDAILTCRLIDRPLRPSFKKGLRNEIQV
VATIMALNPDHLYDVVAINAASASTQLAGLPFSGPIGGVRVALIRGQWVAFPTHTELEDA
VFDMVVAGRVLEDGDVAIMMVEAEATDKTIKLVEGGAEAPTEEVVAAGLDAAKPFIKVLC
RAQADLAAKAAKPTGEFPIFLDFQDDVLEALTGAVKPELTQALTIAGKQEREAELDRVKG
LAAEKLLPEFEGREKEISAAYRALTKSLVRERVIKEKKRIDGRGVTDIRTLAAEVEAIPR
VHGSALFERGETQILGVTTLNMLRMEQQLDTLSPVTRKRYMHNYNFPPYSVGETGRVGSP
KRREIGHGALAERAIVPVLPTREEFPYAIRQVSEALGSNGSTSMGSVCASTMSLLNAGVP
LKAPVAGIAMGLISQEINGETHYVALTDILGAEDAFGDMDFKVAGTKEFVTALQLDTKLD
GIPASVLAAALKQARDARLHILDVMMEAIDTPDEMSPNAPRIITVKIPVDKIGEVIGPKG
KMINQIQEDTGADITIEDDGTIYIGAAQGSQAEAARATINGIANPTMPEVGERYLGTVVK
TTTFGAFVSLLPGKDGLLHISQIRKLAGGKRVENVEDVLGVGAKVQVEIAEIDSRGKLSL
IPVIEGEAGDDDKKDDADK
Download sequence
Identical sequences A0A1H2D1C8 D6EQ58 Q8CJQ6
gi|32141272|ref|NP_733673.1| 100226.SCO5737 NP_733673.1.49638 WP_003973290.1.26049 WP_003973290.1.30910 WP_003973290.1.43399 WP_003973290.1.55229 WP_003973290.1.58943 WP_003973290.1.86682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]