SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO6457 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO6457
Domain Number 1 Region: 1003-1290
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.27e-84
Family beta-Galactosidase, domain 5 0.00025
Further Details:      
 
Domain Number 2 Region: 399-637,844-881
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.88e-74
Family beta-glycanases 0.00000078
Further Details:      
 
Domain Number 3 Region: 61-277
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.94e-63
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000244
Further Details:      
 
Domain Number 4 Region: 877-991
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.51e-24
Family beta-Galactosidase/glucuronidase domain 0.0023
Further Details:      
 
Domain Number 5 Region: 279-396
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 3.96e-22
Family beta-Galactosidase/glucuronidase domain 0.0028
Further Details:      
 
Domain Number 6 Region: 665-810
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-21
Family Laminin G-like module 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO6457
Sequence length 1307
Comment (Streptomyces coelicolor)
Sequence
MPHSPVSPAESPAPQPGRPRPVVSRRRLLEGGAAVLGALALSASPLTAQAAVRRAAADEP
PEWNDFGVFRLGTQPPHATLTPYADVEQALAGDRARSPYRLSLDGTWKFAYADRPEDRDA
DFHRTDVDDGDWGTIPVPSVWQLHGHDFPIYLNITYPYWGPNGQGEEPQPPAAPTRYNPV
GQYRRTFTVPRDWRGRRTFLHFEGVKSAHYVWINGELAGYDEDSYTPSEYDVTDLLKPGT
NQIAVEVYRYSDGDWMEDQDMIRLSGIFRSVHLYSTPAVHLRDFKLDTPLDDTYTGAELA
VTASVRAYGEGGTGRYTVETQLYDARGHAVWSRPLQQPVDVGGARAGEDVTVRAAKAVPK
PRLWSAEHPDLYTAVLRLRDPAGKVTETLSHRVGFREFALKDGLMRINGEPVSIRGTNRH
EMHPARGTALTREDMVEDIKIIKRMNMNSVRTSHYPNNPYWLELADEYGLYLVDETNLET
HGIRGEYPGDHPDWTAACVARAQNMVHRDKNHASVVIWSLGNEAGGGSTFSAMHDWIRSY
DDTRVIQYEGDDRPGVSDIRSEMYDSPQRVEQRAKDTSDTRPYVMIEYAHSMGNSTGNFK
KYWDVVRRYDVLQGGWIWDFVDQSLYTPVPARTLLTEAGPAGLRGEILATRGTLDRDEGL
SGITVFERHDSLDLTGSLTLEAWVTPHVTGYHQPIIAKGDTQYALKQNGRTLEFFIHSEG
QWITANWTVPEDWTGREHHLAGVFDADAGTLTLYVDGVERATRTTDRRPSSNTAPLALAS
DADNQVREFSGTVRRARVYARALGAAELASESRGPGDDGVRFWFDAATVKTSTRRPRDKT
FLAYGGDWGDNPNDGAFVADGIVTADRGHTGKAAEVKRVYQAIDAARTPGGGPGAVTLTN
EYLFTRLREFDGHWELVADGEVVRRGRLTRDQLDVAPRSSKDITVPVRLPGRPGPGTEYF
LQLSFTTKESTPWAKAGFEVARRQLPVAADVPAVTPVRAASVPALRHEDRDREVEVTGRG
FSVTVDKRTGTISSYEAKGTRLITSGPVPNFWRAPTDNDKGNGQHTRNQTWRDAGARRKV
TGVIVRALGDRAVEIKVTGTLPTSVESTYGTTYTVFGNGEIKVDNTLHPGAANLPYIPEV
GTMLFLPRGLDRVHWYGRGPEENHWDRNDGTDVGRYSGTVAEQWTPYIRPQENGNKTDVR
WIALTDRHGVGLLASGEPLLEANASYFTPEDLSAGVRHDYQLTPRDEVVLRLNHRQMGVG
GDNSWGAHTHDEFKLFADRDYAYTYRLRPLTDVRDATRASRRPTATE
Download sequence
Identical sequences Q9ZBF6
gi|21224763|ref|NP_630542.1| 100226.SCO6457 NP_630542.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]