SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100226.SCO6808 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  100226.SCO6808
Domain Number 1 Region: 20-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.05e-26
Family ArsR-like transcriptional regulators 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 100226.SCO6808
Sequence length 120
Comment (Streptomyces coelicolor)
Sequence
MSDDGFLEGGSCGPGLNCQPLERSEAEQLSTILRSIADPTRLQLFRLLEQAPDGEACVCD
LADSLGLRQSTVSHHLKIMTEAGLLDRERRGTWAWFSVNHEGLRRIRSILDPAPQATKEL
Download sequence
Identical sequences Q9L224
NP_630880.1.49638 gi|21225101|ref|NP_630880.1| 100226.SCO6808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]