SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000000326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000000326
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily POZ domain 1.3e-29
Family BTB/POZ domain 0.0000708
Further Details:      
 
Domain Number 2 Region: 360-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 401-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.11e-17
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000000326
Sequence length 474
Comment (Mus musculus)
Sequence
MGSTAAPEGALGYVREFTRHSSDVLSNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACS
GFFYSIFRGRAGLGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQM
EHVVQACHRFIQASYEPLGISLRPVEVEPPRPPTVAPPGSPRRSEGHPDPPTESRSCSQG
SPSPASPDPKACNWKKYKFIVLNSQTSQAGSLVGESSGQPCPQARLPSGDEACSSSSSSE
EGTTPGLQSRLSLATTTARFKCGALANNSYLFTPRAQETSLPASKQANPPPGSEFFSCQN
CEAVAGCSSGLELLAPGDEDKPYKCQLCRSAFRYKGNLASHRTVHTGEKPYRCSICGARF
NRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQ
TLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVRYHILGGP
Download sequence
Identical sequences O88282 Q5BKP3
NP_031554.1.92730 ENSMUSP00000000326 10090.ENSMUSP00000000326 ENSMUSP00000000326 ENSMUSP00000000326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]