SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000003659 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000003659
Domain Number 1 Region: 527-742
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-104
Family Thrombospondin C-terminal domain 0.0000000945
Further Details:      
 
Domain Number 2 Region: 404-525
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.7e-35
Family TSP type-3 repeat 0.00000311
Further Details:      
 
Domain Number 3 Region: 27-72
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.44e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00011
Further Details:      
 
Domain Number 4 Region: 266-347
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000445
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 336-406
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000034
Family TSP type-3 repeat 0.00028
Further Details:      
 
Domain Number 6 Region: 89-227
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000439
Family Growth factor receptor domain 0.021
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000003659
Domain Number - Region: 224-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000675
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000003659
Sequence length 755
Comment (Mus musculus)
Sequence
MGPTACVLVLALAILRATGQGQIPLGGDLAPQMLRELQETNAALQDVRELLRQQVKEITF
LKNTVMECDACGMQPARTPGLSVRPVPLCAPGSCFPGVVCSETATGARCGPCPPGYTGNG
SHCTDVNECNAHPCFPRVRCINTSPGFHCEACPPGFSGPTHEGVGLTFAKSNKQVCTDIN
ECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQTSGCQRRGQHFCPDGSPSPCHEKAN
CVLERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQED
VDRDGIGDACDPDADGDGVPNEQDNCPLVRNPDQRNSDSDKWGDACDNCRSKKNDDQKDT
DLDGRGDACDDDIDGDRIRNVADNCPRVPNFDQSDSDGDGVGDACDNCPQKDNPDQRDVD
HDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGKGDACDDDDDNDGVPDSRD
NCRLVPNPGQEDNDRDGVGDACQGDFDADKVIDKIDVCPENAEVTLTDFRAFQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIFG
YQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTAS
QVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTAMRGGRL
GVFCFSQENIIWANLRYRCNDTIPEDYESHRLQRV
Download sequence
Identical sequences Q9R0G6
ENSMUSP00000003659 10090.ENSMUSP00000003659 NP_057894.2.92730 ENSMUSP00000003659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]