SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000004784 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000004784
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.95e-51
Family Calponin-homology domain, CH-domain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000004784
Sequence length 305
Comment (Mus musculus)
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRSWIEGLTGLSIGPDFQKGLKDGVIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSG
MTAYGTRRHLYDPKNHILPPMDHCTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKC
DNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGSAADGAPAGDGQGEAPEYLAYCQ
EEAGY
Download sequence
Identical sequences Q08093 Q543F3
ENSMUSP00000004784 ENSMUSP00000004784 10090.ENSMUSP00000004784 NP_031751.1.92730 ENSMUSP00000004784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]