SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000005509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000005509
Domain Number 1 Region: 28-247
Classification Level Classification E-value
Superfamily t-snare proteins 2.09e-71
Family t-snare proteins 0.00000000179
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000005509
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily HSC20 (HSCB), C-terminal oligomerisation domain 0.0157
Family HSC20 (HSCB), C-terminal oligomerisation domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000005509
Sequence length 288
Comment (Mus musculus)
Sequence
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
Download sequence
Identical sequences O35526 Q497P1
ENSMUSP00000005509 10090.ENSMUSP00000005509 ENSMUSP00000005509 NP_058081.2.92730 ENSMUSP00000005509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]